PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04189.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 340aa    MW: 36547.1 Da    PI: 6.5673
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04189.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.81.4e-051244434
                      zf-B_box  4 rkCpeHeekelqlfCedCqq.llCedCllee.H 34
                                  r+C  +e  ++  +C++C+  +lC  C     H
  Zmw_sc04189.1.g00080.1.sm.mk 12 RRCGACETAPAAVHCRTCGGvFLCTACDARPaH 44
                                  79****************876******876555 PP

2CCT70.63.8e-24262305144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Zmw_sc04189.1.g00080.1.sm.mk 262 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 305
                                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000218.16E-51280No hitNo description
SMARTSM003361.4E-52180IPR000315B-box-type zinc finger
PROSITE profilePS5101716.896262304IPR010402CCT domain
PfamPF062036.0E-18262304IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELHKYWGVG GRRCGACETA PAAVHCRTCG GVFLCTACDA RPAHAGAXXX XXXXAVLCAA  60
CDADIHEANP LARRHTRVPI APIGSAAAAA AVESMLFGTG EAAEEQKATE HHQHQHSLNL  120
NVEAKDMKLD YLFSDLDPYL NVELPRFQHA DSVVPNGVAV ELDFTGGVGV KPSSYSPYAA  180
TSLAHSGSSS EVGVVPDALC VGGGHGSFEL DFTRPKTQAY MPYTATPPSH SVTVSSVDAA  240
EVVPDQRGEA AAVPRPVTGE GREARLMRYR EKRKNRRFEK TIRYASRKAY AETRPRIKGR  300
FAKRTDNDGD GDDAEPEAEG TVPTASSYMF DFGYSVVPTF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148229.11e-144CONSTANS-like protein CO6
TrEMBLA0A0E0LE711e-145A0A0E0LE71_ORYPU; Uncharacterized protein
STRINGGRMZM2G038783_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348